General Information

  • ID:  hor007108
  • Uniprot ID:  P84809??24-95)
  • Protein name:  Lipolysis-activating peptide 1-beta chain
  • Gene name:  FSHB
  • Organism:  Buthus occitanus tunetanus
  • Family:  Long (3 C-C) scorpion toxin superfamily
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Scorpiones; Buthida; Buthoidea; Buthidae; Buthus; Buthus occitanus (Common European scorpion); Buthus occitanus tunetanus (Common European scorpion) (Buthus tunetanus)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0008200 ion channel inhibitor activity; GO:0090729 toxin activity; GO:0015459 potassium channel regulator activity; GO:0017080 sodium channel regulator activity
  • GO CC:  GO:0006952 defense response; GO:0050996 positive regulation of lipid catabolic process

Sequence Information

  • Sequence:  NVFPNRELGILYGCKGYGNAFCDKVCKMHLARGGGRCGEPNPVMWACECIDIDEDNGYFLNALEKQCPLLKG
  • Length:  72
  • Propeptide:  MISVQVIFIAFISIIAFSMVCGGNVFPNRELGILYGCKGYGNAFCDKVCKMHLARGGGRCGEPNPVMWACECIDIDEDNGYFLNALEKQCPLLKG
  • Signal peptide:  NA
  • Modification:  T19 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA